Nephronectin anticorps (Middle Region)

N° du produit ABIN630784

Détail du produit anti-Nephronectin anticorps

Antigène: Nephronectin (NPNT)

Épitope: Middle Region

Reactivité: Humain, Souris, Chien, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Nephronectin est non-conjugé

Application: Western Blotting (WB)

Specificité: Nephronectin antibody was raised against the middle region of NPNT

Purification: Affinity purified

Immunogène: Nephronectin antibody was raised using the middle region of NPNT corresponding to a region with amino acids TTGLTTIAPAASTPPGGITVDNRVQTDPQKPRGDVFIPRQPSNDLFEIFE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Nephronectin Blocking Peptide, catalog no. 33R-9316, is also available for use as a blocking control in assays to test for specificity of this Nephronectin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NPNT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Nephronectin

Antigène: Nephronectin (NPNT)

Autre désignation: Nephronectin (NPNT Produits)

Synonymes: anticorps POEM, anticorps si:ch211-202n8.2, anticorps egfl6l, anticorps 1110009H02Rik, anticorps AA682063, anticorps AI314031, anticorps Nctn, anticorps EGFL6L, anticorps nephronectin, anticorps NPNT, anticorps npnt, anticorps Npnt

Sujet: NPNT is a functional ligand of integrin alpha-8/beta-1 in kidney development. It regulates with integrin alpha-8/beta-1 the expression of GDNF which is essential for kidney development. It may also play a role in the development and function of various tissues, regulating cell adhesion, spreading and survival through the binding of several integrins.

Poids moléculaire: 62 kDa (MW of target protein)