ABAT anticorps (Middle Region)
-
- Antigène Voir toutes ABAT Anticorps
- ABAT (4-Aminobutyrate Aminotransferase (ABAT))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ABAT est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ABAT antibody was raised against the middle region of ABAT
- Purification
- Affinity purified
- Immunogène
- ABAT antibody was raised using the middle region of ABAT corresponding to a region with amino acids IIVEPIQSEGGDNHASDDFFRKLRDIARKHGCAFLVDEVQTGGGCTGKFW
- Top Product
- Discover our top product ABAT Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ABAT Blocking Peptide, catalog no. 33R-4009, is also available for use as a blocking control in assays to test for specificity of this ABAT antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABAT antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ABAT (4-Aminobutyrate Aminotransferase (ABAT))
- Autre désignation
- ABAT (ABAT Produits)
- Synonymes
- anticorps cb880, anticorps fj82a01, anticorps wu:fj82a01, anticorps BA0325, anticorps PSPTO0259, anticorps PSPTO0301, anticorps PSPTO1890, anticorps GABA-AT, anticorps GABAT, anticorps NPD009, anticorps GABA-T, anticorps L-AIBAT, anticorps 9630038C02Rik, anticorps AI255750, anticorps ENSMUSG00000051226, anticorps Gabaat, anticorps Gabat, anticorps Gm9851, anticorps I54, anticorps Laibat, anticorps X61497, anticorps beta-AlaAT, anticorps 4-aminobutyrate aminotransferase, anticorps 4-aminobutyrate--2-oxoglutarate transaminase, anticorps GABA aminotransferase PLP-dependent PuuE, anticorps 4-aminobutyrate aminotransferase, mitochondrial, anticorps aspartate aminotransferase family protein, anticorps 4-aminobutyrate aminotransferase S homeolog, anticorps ABAT, anticorps abat, anticorps gabT, anticorps puuE, anticorps gabT-1, anticorps gabT-2, anticorps gabT-3, anticorps CNE01830, anticorps Mmwyl1_0047, anticorps CpipJ_CPIJ008729, anticorps KCR_RS04555, anticorps Bcenmc03_4909, anticorps Hden_0972, anticorps Dbac_2000, anticorps Mesil_2400, anticorps Trad_0121, anticorps abat.S, anticorps Abat
- Sujet
- 4-aminobutyrate aminotransferase (ABAT) is responsible for catabolism of gamma-aminobutyric acid (GABA), an important, mostly inhibitory neurotransmitter in the central nervous system, into succinic semialdehyde. The active enzyme is a homodimer of 50 kDa subunits complexed to pyridoxal-5-phosphate. ABAT in liver and brain is controlled by 2 codominant alleles with a frequency in a Caucasian population of 0.56 and 0.44. The ABAT deficiency phenotype includes psychomotor retardation, hypotonia, hyperreflexia, lethargy, refractory seizures, and EEG abnormalities.4-aminobutyrate aminotransferase (ABAT) is responsible for catabolism of gamma-aminobutyric acid (GABA), an important, mostly inhibitory neurotransmitter in the central nervous system, into succinic semialdehyde
- Poids moléculaire
- 55 kDa (MW of target protein)
- Pathways
- Monocarboxylic Acid Catabolic Process
-