SULT1C2 anticorps (C-Term)

N° du produit ABIN630789

Détail du produit anti-SULT1C2 anticorps

Antigène: SULT1C2 (Sulfotransferase Family, Cytosolic, 1C, Member 2 (SULT1C2))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SULT1C2 est non-conjugé

Application: Western Blotting (WB)

Specificité: SULT1 C2 antibody was raised against the C terminal of SULT1 2

Purification: Affinity purified

Immunogène: SULT1 C2 antibody was raised using the C terminal of SULT1 2 corresponding to a region with amino acids LDQSISSFMRKGTVGDWKNHFTVAQNERFDEIYRRKMEGTSINFCMEL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SULT1C2 Blocking Peptide, catalog no. 33R-4859, is also available for use as a blocking control in assays to test for specificity of this SULT1C2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SULT0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SULT1C2

Antigène: SULT1C2 (Sulfotransferase Family, Cytosolic, 1C, Member 2 (SULT1C2))

Autre désignation: SULT1C2 (SULT1C2 Produits)

Synonymes: anticorps ST1C1, anticorps ST1C2, anticorps SULT1C1, anticorps humSULTC2, anticorps 1810008N17Rik, anticorps Sult1c1, anticorps st1c1, anticorps st1c2, anticorps sult1c1, anticorps MGC88979, anticorps SULT1C2, anticorps Sult1c2, anticorps sulfotransferase family 1C member 2, anticorps sulfotransferase family, cytosolic, 1C, member 2, anticorps sulfotransferase family 1C member 2 S homeolog, anticorps sulfotransferase 1C2, anticorps SULT1C2, anticorps Sult1c2, anticorps sult1c2, anticorps sult1c2.S, anticorps LOC100060302, anticorps LOC100729651, anticorps LOC100623541

Sujet: Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. SULT1C2 is a protein that belongs to the SULT1 subfamily, responsible for transferring a sulfo moiety from PAPS to phenol-containing compounds.

Poids moléculaire: 35 kDa (MW of target protein)