HBXIP anticorps (N-Term)

N° du produit ABIN630790

Détail du produit anti-HBXIP anticorps

Antigène: HBXIP (Hepatitis B Virus X-Interacting Protein (HBXIP))

Épitope: N-Term

Reactivité: Hepatitis B Virus (HBV)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HBXIP est non-conjugé

Application: Western Blotting (WB)

Specificité: HBXIP antibody was raised against the N terminal of HBXIP

Purification: Affinity purified

Immunogène: HBXIP antibody was raised using the N terminal of HBXIP corresponding to a region with amino acids EPGAGHLDGHRAGSPSLRQALCDGSAVMFSSKERGRCTVINFVPLEAPLR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HBXIP Blocking Peptide, catalog no. 33R-2632, is also available for use as a blocking control in assays to test for specificity of this HBXIP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HBXIP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HBXIP

Antigène: HBXIP (Hepatitis B Virus X-Interacting Protein (HBXIP))

Abstract: HBXIP Produits

Synonymes: anticorps HBXIP, anticorps xip, anticorps XIP, anticorps 1110003H18Rik, anticorps Hbxip, anticorps late endosomal/lysosomal adaptor, MAPK and MTOR activator 5, anticorps Hepatitis B virus X-interacting protein, anticorps LAMTOR5, anticorps xip, anticorps Lamtor5

Classe de substances: Viral Protein

Sujet: HBXIP is a protein that specifically complexes with the C-terminus of hepatitis B virus X protein (HBx). The function of this protein is to negatively regulate HBx activity and thus to alter the replication life cycle of the virus.

Poids moléculaire: 18 kDa (MW of target protein)

Pathways: Signalisation PI3K-Akt, Regulation of Cell Size