AKTIP anticorps (Middle Region)
-
- Antigène Voir toutes AKTIP Anticorps
- AKTIP (AKT Interacting Protein (AKTIP))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp AKTIP est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- AKTIP antibody was raised against the middle region of AKTIP
- Purification
- Affinity purified
- Immunogène
- AKTIP antibody was raised using the middle region of AKTIP corresponding to a region with amino acids NPSVHDEAREKMLTQKKPEEQHNKSVHVAGLSWVKPGSVQPFSKEEKTVA
- Top Product
- Discover our top product AKTIP Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
AKTIP Blocking Peptide, catalog no. 33R-6833, is also available for use as a blocking control in assays to test for specificity of this AKTIP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AKTIP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- AKTIP (AKT Interacting Protein (AKTIP))
- Autre désignation
- AKTIP (AKTIP Produits)
- Synonymes
- anticorps FT1, anticorps FTS, anticorps cb798, anticorps fts, anticorps zgc:77699, anticorps fts-A, anticorps aktip, anticorps fts-B, anticorps MGC133931, anticorps AL023020, anticorps Fif, anticorps Ft, anticorps Ft1, anticorps Fts, anticorps AKT interacting protein, anticorps akt interacting protein, anticorps AKT interacting protein L homeolog, anticorps AKT interacting protein S homeolog, anticorps thymoma viral proto-oncogene 1 interacting protein, anticorps AKTIP, anticorps aktip, anticorps aktip.L, anticorps aktip.S, anticorps Aktip
- Sujet
- AKTIP is the component of the FTS/Hook/FHIP complex (FHF complex). The FHF complex may function to promote vesicle trafficking and/or fusion via the homotypic vesicular protein sorting complex (the HOPS complex). AKTIP regulates apoptosis by enhancing phosphorylation and activation of AKT1. AKTIP increases release of TNFSF6 via the AKT1/GSK3B/NFATC1 signaling cascade.
- Poids moléculaire
- 33 kDa (MW of target protein)
-