TRIM45 anticorps (N-Term)

N° du produit ABIN630795

Détail du produit anti-TRIM45 anticorps

Antigène: TRIM45 (Tripartite Motif Containing 45 (TRIM45))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TRIM45 est non-conjugé

Application: Western Blotting (WB)

Specificité: TRIM45 antibody was raised against the N terminal of TRIM45

Purification: Affinity purified

Immunogène: TRIM45 antibody was raised using the N terminal of TRIM45 corresponding to a region with amino acids FKAPRLLPCLHTVCTTCLEQLEPFSVVDIRGGDSDTSSEGSIFQELKPRS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TRIM45 Blocking Peptide, catalog no. 33R-2941, is also available for use as a blocking control in assays to test for specificity of this TRIM45 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIM45 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TRIM45

Antigène: TRIM45 (Tripartite Motif Containing 45 (TRIM45))

Autre désignation: TRIM45 (TRIM45 Produits)

Synonymes: anticorps RNF99, anticorps 4921530N01Rik, anticorps tripartite motif containing 45, anticorps tripartite motif-containing 45, anticorps TRIM45, anticorps trim45, anticorps Trim45

Sujet: TRIM45 is a member of the tripartite motif family. It may function as a transcriptional repressor of the mitogen-activated protein kinase pathway. Alternatively spliced transcript variants have been described.

Poids moléculaire: 64 kDa (MW of target protein)