URGCP anticorps (Middle Region)
-
- Antigène Voir toutes URGCP Anticorps
- URGCP (Upregulator of Cell Proliferation (URGCP))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp URGCP est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- URG4 antibody was raised against the middle region of URG4
- Purification
- Affinity purified
- Immunogène
- URG4 antibody was raised using the middle region of URG4 corresponding to a region with amino acids AILHAFLRLEKTGHMPNYQFVYQNLHDVSVPGPRPRDKRQLLDPPGDLSR
- Top Product
- Discover our top product URGCP Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
URG4 Blocking Peptide, catalog no. 33R-1272, is also available for use as a blocking control in assays to test for specificity of this URG4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of URG4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- URGCP (Upregulator of Cell Proliferation (URGCP))
- Autre désignation
- URG4 (URGCP Produits)
- Synonymes
- anticorps URG4, anticorps DKFZp469D1721, anticorps urg4, anticorps MGC132266, anticorps 2010005J08Rik, anticorps 9130001I21Rik, anticorps AW060359, anticorps Urg4, anticorps mKIAA1507, anticorps RGD1564681, anticorps up-regulator of cell proliferation, anticorps upregulator of cell proliferation, anticorps LOC610578, anticorps LOC100064842, anticorps URGCP, anticorps urgcp, anticorps Urgcp
- Sujet
- URG4 is upregulated in the presence of hepatitis B virus (HBV)-encoded X antigen (HBxAg) and may contribute to the development of hepatocellular carcinoma by promoting hepatocellular growth and survival.
- Poids moléculaire
- 100 kDa (MW of target protein)
-