GPSM2 anticorps

N° du produit ABIN630807

Détail du produit anti-GPSM2 anticorps

Antigène: GPSM2 (G-Protein Signaling Modulator 2 (GPSM2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GPSM2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: GPSM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids YFYLHDYAKALEYHHHDLTLARTIGDQLGEAKASGNLGNTLKVLGNFDEA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GPSM2 Blocking Peptide, catalog no. 33R-10101, is also available for use as a blocking control in assays to test for specificity of this GPSM2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPSM2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GPSM2

Antigène: GPSM2 (G-Protein Signaling Modulator 2 (GPSM2))

Autre désignation: GPSM2 (GPSM2 Produits)

Synonymes: anticorps CMCS, anticorps DFNB82, anticorps LGN, anticorps PINS, anticorps dfnb82, anticorps lgn, anticorps pins, anticorps RGD1560967, anticorps Pinsa, anticorps zgc:63574, anticorps 6230410J09Rik, anticorps Pins, anticorps G protein signaling modulator 2, anticorps G-protein signaling modulator 2 S homeolog, anticorps G-protein signaling modulator 2, anticorps G-protein signalling modulator 2 (AGS3-like, C. elegans), anticorps GPSM2, anticorps gpsm2.S, anticorps Gpsm2, anticorps gpsm2

Sujet: Heterotrimeric G proteins transduce extracellular signals received by cell surface receptors into integrated cellular responses. GPSM2 belongs to a group of proteins that modulate activation of G proteins.

Poids moléculaire: 76 kDa (MW of target protein)

Pathways: Regulation of G-Protein Coupled Receptor Protein Signaling