GTPBP4 anticorps (C-Term)
-
- Antigène Voir toutes GTPBP4 Anticorps
- GTPBP4 (GTP Binding Protein 4 (GTPBP4))
-
Épitope
- C-Term
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GTPBP4 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- GTPBP4 antibody was raised against the C terminal of GTPBP4
- Purification
- Affinity purified
- Immunogène
- GTPBP4 antibody was raised using the C terminal of GTPBP4 corresponding to a region with amino acids MVKKAKTMMKNAQKKMNRLGKKGEADRHVFDMKPKHLLSGKRKAGKKDRR
- Top Product
- Discover our top product GTPBP4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GTPBP4 Blocking Peptide, catalog no. 33R-6589, is also available for use as a blocking control in assays to test for specificity of this GTPBP4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GTPBP4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GTPBP4 (GTP Binding Protein 4 (GTPBP4))
- Autre désignation
- GTPBP4 (GTPBP4 Produits)
- Synonymes
- anticorps CRFG, anticorps NGB, anticorps NOG1, anticorps 2610028C09Rik, anticorps Crfg, anticorps Gtpbp3, anticorps Nog1, anticorps fi28d07, anticorps zgc:55757, anticorps wu:fi28d07, anticorps xgb, anticorps GTP binding protein 4, anticorps GTP binding protein 4 L homeolog, anticorps GTPBP4, anticorps Gtpbp4, anticorps gtpbp4, anticorps CC1G_14285, anticorps gtpbp4.L
- Sujet
- GTP-binding proteins are GTPases and function as molecular switches that can flip between two states: active, when GTP is bound, and inactive, when GDP is bound. 'Active' in this context usually means that the molecule acts as a signal to trigger other events in the cell. When an extracellular ligand binds to a G-protein-linked receptor, the receptor changes its conformation and switches on the trimeric G proteins that associate with it by causing them to eject their GDP and replace it with GTP. The switch is turned off when the G protein hydrolyzes its own bound GTP, converting it back to GDP. But before that occurs, the active protein has an opportunity to diffuse away from the receptor and deliver its message for a prolonged period to its downstream target.
- Poids moléculaire
- 74 kDa (MW of target protein)
-