FBXO24 anticorps (Middle Region)

N° du produit ABIN630822

Détail du produit anti-FBXO24 anticorps

Antigène: FBXO24 (F-Box Protein 24 (FBXO24))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FBXO24 est non-conjugé

Application: Western Blotting (WB)

Specificité: FBXO24 antibody was raised against the middle region of FBXO24

Purification: Affinity purified

Immunogène: FBXO24 antibody was raised using the middle region of FBXO24 corresponding to a region with amino acids EGKIYSLVVNETQLDQPRSYTVQLALRKVSHYLPHLRVACMTSNQSSTLY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FBXO24 Blocking Peptide, catalog no. 33R-2436, is also available for use as a blocking control in assays to test for specificity of this FBXO24 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO24 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FBXO24

Antigène: FBXO24 (F-Box Protein 24 (FBXO24))

Autre désignation: FBXO24 (FBXO24 Produits)

Synonymes: anticorps FBX24, anticorps 4933422D21Rik, anticorps Fbx24, anticorps F-box protein 24, anticorps FBXO24, anticorps Fbxo24, anticorps fbxo24

Sujet: FBXO24 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination.

Poids moléculaire: 36 kDa (MW of target protein)