FBXO24 anticorps (Middle Region)
-
- Antigène Voir toutes FBXO24 Anticorps
- FBXO24 (F-Box Protein 24 (FBXO24))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp FBXO24 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- FBXO24 antibody was raised against the middle region of FBXO24
- Purification
- Affinity purified
- Immunogène
- FBXO24 antibody was raised using the middle region of FBXO24 corresponding to a region with amino acids EGKIYSLVVNETQLDQPRSYTVQLALRKVSHYLPHLRVACMTSNQSSTLY
- Top Product
- Discover our top product FBXO24 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
FBXO24 Blocking Peptide, catalog no. 33R-2436, is also available for use as a blocking control in assays to test for specificity of this FBXO24 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO24 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- FBXO24 (F-Box Protein 24 (FBXO24))
- Autre désignation
- FBXO24 (FBXO24 Produits)
- Sujet
- FBXO24 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination.
- Poids moléculaire
- 36 kDa (MW of target protein)
-