RNF44 anticorps (N-Term)

N° du produit ABIN630824

Détail du produit anti-RNF44 anticorps

Antigène: RNF44 (Ring Finger Protein 44 (RNF44))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RNF44 est non-conjugé

Application: Western Blotting (WB)

Specificité: RNF44 antibody was raised against the N terminal of RNF44

Purification: Affinity purified

Immunogène: RNF44 antibody was raised using the N terminal of RNF44 corresponding to a region with amino acids LSYTVTTVTTQGFPLPTGQHIPGCSAQQLPACSVMFSGQHYPLCCLPPPL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RNF44 Blocking Peptide, catalog no. 33R-5467, is also available for use as a blocking control in assays to test for specificity of this RNF44 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF44 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RNF44

Antigène: RNF44 (Ring Finger Protein 44 (RNF44))

Autre désignation: RNF44 (RNF44 Produits)

Synonymes: anticorps AI854545, anticorps mKIAA1100, anticorps ring finger protein 44, anticorps RNF44, anticorps Rnf44

Sujet: The protein encoded by this gene contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions.

Poids moléculaire: 48 kDa (MW of target protein)