AKR1B1 anticorps

N° du produit ABIN630825

Détail du produit anti-AKR1B1 anticorps

Antigène: AKR1B1 (Aldo-Keto Reductase Family 1, Member B1 (Aldose Reductase) (AKR1B1))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AKR1B1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: AKR1 B1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

AKR1B1 Blocking Peptide, catalog no. 33R-1528, is also available for use as a blocking control in assays to test for specificity of this AKR1B1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AKR0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur AKR1B1

Antigène: AKR1B1 (Aldo-Keto Reductase Family 1, Member B1 (Aldose Reductase) (AKR1B1))

Autre désignation: AKR1B1 (AKR1B1 Produits)

Synonymes: anticorps ADR, anticorps ALDR1, anticorps ALR2, anticorps AR, anticorps ALDRED, anticorps ALR-P-I, anticorps Akr1b3, anticorps Akr1b4, anticorps Aldr1, anticorps Alr, anticorps RATALDRED, anticorps akr1b7, anticorps zgc:86611, anticorps aldo-keto reductase family 1 member B, anticorps aldo-keto reductase family 1, member B1 (aldose reductase), anticorps aldo-keto reductase family 1, member B1 (aldose reductase) S homeolog, anticorps AKR1B1, anticorps Akr1b1, anticorps akr1b1.S, anticorps akr1b1

Sujet: AKR1B1 is a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member catalyzes the reduction of a number of aldehydes, including the aldehyde form of glucose, and is thereby implicated in the development of diabetic complications by catalyzing the reduction of glucose to sorbitol.

Poids moléculaire: 36 kDa (MW of target protein)

Pathways: Metabolism of Steroid Hormones and Vitamin D, C21-Steroid Hormone Metabolic Process, Monocarboxylic Acid Catabolic Process