LIAS anticorps (N-Term)

N° du produit ABIN630827

Détail du produit anti-LIAS anticorps

Antigène: LIAS (Lipoic Acid Synthetase (LIAS))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LIAS est non-conjugé

Application: Western Blotting (WB)

Specificité: LIAS antibody was raised against the N terminal of LIAS

Purification: Affinity purified

Immunogène: LIAS antibody was raised using the N terminal of LIAS corresponding to a region with amino acids LLQNGPDLQDFVSGDLADRSTWDEYKGNLKRQKGERLRLPPWLKTEIPMG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LIAS Blocking Peptide, catalog no. 33R-5181, is also available for use as a blocking control in assays to test for specificity of this LIAS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIAS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LIAS

Antigène: LIAS (Lipoic Acid Synthetase (LIAS))

Autre désignation: LIAS (LIAS Produits)

Synonymes: anticorps LAS, anticorps LIP1, anticorps LS, anticorps PDHLD, anticorps 2900022L22Rik, anticorps 4933425M12Rik, anticorps 7a5ex, anticorps C77512, anticorps mLip1, anticorps zgc:66080, anticorps Lip-syn, anticorps lipoyl synthase, mitochondrial, anticorps lipoic acid synthetase, anticorps lipoyl synthase, anticorps lipoic acid synthetase S homeolog, anticorps Lipoyl synthase, mitochondrial, anticorps LOC5571879, anticorps THAPSDRAFT_31845, anticorps THAPSDRAFT_31673, anticorps UREG_00501, anticorps LOAG_04019, anticorps TERG_02451, anticorps Tsp_01534, anticorps LIAS, anticorps Lias, anticorps lias, anticorps lias.S, anticorps umc2251

Sujet: LIAS belongs to the biotin and lipoic acid synthetases family. It localizes in mitochondrion and plays an important role in alpha-(+)-lipoic acid synthesis. It may also function in the sulfur insertion chemistry in lipoate biosynthesis.

Poids moléculaire: 39 kDa (MW of target protein)

Pathways: Tube Formation