ATE1 anticorps (N-Term)

N° du produit ABIN630829

Détail du produit anti-ATE1 anticorps

Antigène: ATE1 (Arginyltransferase 1 (ATE1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ATE1 est non-conjugé

Application: Western Blotting (WB)

Specificité: ATE1 antibody was raised against the N terminal of ATE1

Purification: Affinity purified

Immunogène: ATE1 antibody was raised using the N terminal of ATE1 corresponding to a region with amino acids CCPQYTIRCRPLQFQPSKSHKKVLKKMLKFLAKGEVPKGSCEDEPMDSTM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ATE1 Blocking Peptide, catalog no. 33R-1654, is also available for use as a blocking control in assays to test for specificity of this ATE1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ATE1

Antigène: ATE1 (Arginyltransferase 1 (ATE1))

Autre désignation: ATE1 (ATE1 Produits)

Synonymes: anticorps ATE1, anticorps Ate, anticorps CG9204, anticorps Dm-Ate1, anticorps Dmel\\CG9204, anticorps ate1, anticorps l(2)k10809, anticorps zgc:158849, anticorps AI225793, anticorps AW547406, anticorps CG9204 gene product from transcript CG9204-RA, anticorps arginyltransferase 1, anticorps arginyltransferase 1 L homeolog, anticorps Ate1, anticorps ATE1, anticorps ate1, anticorps ate1.L

Sujet: ATE1 is an arginyltransferase, an enzyme that is involved in posttranslational conjugation of arginine to N-terminal aspartate or glutamate residues. Conjugation of arginine to the N-terminal aspartate or glutamate targets proteins for ubiquitin-dependent degradation. Alternative splicing results in two transcript variants encoding distinct isoforms.

Poids moléculaire: 59 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome