NHEDC1 anticorps (N-Term)
-
- Antigène Voir toutes NHEDC1 Anticorps
- NHEDC1 (Na+/H+ Exchanger Domain Containing 1 (NHEDC1))
-
Épitope
- N-Term
- Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NHEDC1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- NHEDC1 antibody was raised against the N terminal of NHEDC1
- Purification
- Affinity purified
- Immunogène
- NHEDC1 antibody was raised using the N terminal of NHEDC1 corresponding to a region with amino acids MHTTESKNEHLEDENFQTSTTPQSLIDPNNTAHEETKTVLSDTEEIKPQT
- Top Product
- Discover our top product NHEDC1 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
NHEDC1 Blocking Peptide, catalog no. 33R-6104, is also available for use as a blocking control in assays to test for specificity of this NHEDC1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NHEDC1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- NHEDC1 (Na+/H+ Exchanger Domain Containing 1 (NHEDC1))
- Autre désignation
- NHEDC1 (NHEDC1 Produits)
- Synonymes
- anticorps NHA1, anticorps NHEDC1, anticorps 1700094G20Rik, anticorps 4933424B12Rik, anticorps 4933425K02Rik, anticorps AV258602, anticorps Nhedc1, anticorps mtsNHE, anticorps solute carrier family 9 member B1, anticorps solute carrier family 9, subfamily B (NHA1, cation proton antiporter 1), member 1, anticorps SLC9B1, anticorps Slc9b1
- Sujet
- NHEDC1 is a sodium/hydrogen exchanger and transmembrane protein. Highly conserved orthologs of this gene have been found in other mammalian species. The expression of NHEDC1 may be limited to testis.
- Poids moléculaire
- 52 kDa (MW of target protein)
-