PNPLA8 anticorps (Middle Region)

N° du produit ABIN630834

Détail du produit anti-PNPLA8 anticorps

Antigène: PNPLA8 (Patatin-Like phospholipase Domain Containing 8 (PNPLA8))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PNPLA8 est non-conjugé

Application: Western Blotting (WB)

Specificité: PNPLA8 antibody was raised against the middle region of PNPLA8

Purification: Affinity purified

Immunogène: PNPLA8 antibody was raised using the middle region of PNPLA8 corresponding to a region with amino acids IDNRTRALVQALRRTTDPKLCITRVEELTFHLLEFPEGKGVAVKERIIPY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PNPLA8 Blocking Peptide, catalog no. 33R-3926, is also available for use as a blocking control in assays to test for specificity of this PNPLA8 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PNPLA8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PNPLA8

Antigène: PNPLA8 (Patatin-Like phospholipase Domain Containing 8 (PNPLA8))

Autre désignation: PNPLA8 (PNPLA8 Produits)

Synonymes: anticorps IPLA2(GAMMA), anticorps IPLA2-2, anticorps IPLA2G, anticorps iPLA2gamma, anticorps 1200006O19Rik, anticorps AI467579, anticorps Ipla2(gamma), anticorps RGD1311444, anticorps iPLA2, anticorps patatin like phospholipase domain containing 8, anticorps patatin-like phospholipase domain containing 8, anticorps PNPLA8, anticorps Pnpla8

Sujet: Phospholipase A2 catalyzes cleavage of fatty acids from phospholipids, thereby regulating membrane physical properties and the release of lipid second messengers and growth factors.

Poids moléculaire: 88 kDa (MW of target protein)