Transglutaminase 5 anticorps (C-Term)
-
- Antigène Voir toutes Transglutaminase 5 (TGM5) Anticorps
- Transglutaminase 5 (TGM5)
-
Épitope
- C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Transglutaminase 5 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Transglutaminase 5 antibody was raised against the C terminal of TGM5
- Purification
- Affinity purified
- Immunogène
- Transglutaminase 5 antibody was raised using the C terminal of TGM5 corresponding to a region with amino acids VLKPQHQASIILETVPFKSGQRQIQANMRSNKFKDIKGYRNVYVDFAL
- Top Product
- Discover our top product TGM5 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Transglutaminase 5 Blocking Peptide, catalog no. 33R-9671, is also available for use as a blocking control in assays to test for specificity of this Transglutaminase 5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TGM5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Transglutaminase 5 (TGM5)
- Autre désignation
- Transglutaminase 5 (TGM5 Produits)
- Synonymes
- anticorps TGM5, anticorps TGASE5, anticorps TGASEX, anticorps TGMX, anticorps TGX, anticorps 2310007C07Rik, anticorps TGx, anticorps transglutaminase 5, anticorps TGM5, anticorps tgm5, anticorps Tgm5
- Sujet
- TGM5 belongs to the transglutaminase superfamily, transglutaminase family. It catalyzes the cross-linking of proteins and the conjugation of polyamines to proteins. It contributes to the formation of the cornified cell envelope of keratinocytes. Defects in TGM5 are a cause of peeling skin syndrome acral type (APSS).
- Poids moléculaire
- 81 kDa (MW of target protein)
-