Cytokeratin 13 anticorps (N-Term)
-
- Antigène Voir toutes Cytokeratin 13 (KRT13) Anticorps
- Cytokeratin 13 (KRT13) (Keratin 13 (KRT13))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Cytokeratin 13 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Cytokeratin 13 antibody was raised against the N terminal of KRT13
- Purification
- Affinity purified
- Immunogène
- Cytokeratin 13 antibody was raised using the N terminal of KRT13 corresponding to a region with amino acids TMQNLNDRLASYLEKVRALEEANADLEVKIRDWHLKQSPASPERDYSPYY
- Top Product
- Discover our top product KRT13 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Cytokeratin 13 Blocking Peptide, catalog no. 33R-9208, is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 13 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRT13 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Cytokeratin 13 (KRT13) (Keratin 13 (KRT13))
- Autre désignation
- Cytokeratin 13 (KRT13 Produits)
- Synonymes
- anticorps krt13, anticorps CK13, anticorps K13, anticorps Ka13, anticorps Krt-1.13, anticorps Krt1-13, anticorps ck13, anticorps k13, anticorps keratin 24, anticorps keratin 13, anticorps keratin 13, type I S homeolog, anticorps krt24, anticorps KRT13, anticorps Krt13, anticorps krt13.S, anticorps k13
- Sujet
- KRT13 is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins.
- Poids moléculaire
- 46 kDa (MW of target protein)
-