Peroxiredoxin 2 anticorps (Middle Region)
-
- Antigène Voir toutes Peroxiredoxin 2 (PRDX2) Anticorps
- Peroxiredoxin 2 (PRDX2)
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Peroxiredoxin 2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PRDX2 antibody was raised against the middle region of PRDX2
- Purification
- Affinity purified
- Immunogène
- PRDX2 antibody was raised using the middle region of PRDX2 corresponding to a region with amino acids VLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTD
- Top Product
- Discover our top product PRDX2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PRDX2 Blocking Peptide, catalog no. 33R-9664, is also available for use as a blocking control in assays to test for specificity of this PRDX2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRDX2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Peroxiredoxin 2 (PRDX2)
- Autre désignation
- PRDX2 (PRDX2 Produits)
- Synonymes
- anticorps NKEF-B, anticorps NKEFB, anticorps PRP, anticorps PRX2, anticorps PRXII, anticorps PTX1, anticorps TDPX1, anticorps TPX1, anticorps TSA, anticorps AL022839, anticorps Band-8, anticorps NkefB, anticorps PrxII, anticorps TDX1, anticorps TPx, anticorps TPx-B, anticorps TR, anticorps Tdpx1, anticorps Torin, anticorps nkefb, anticorps prx-2, anticorps prx2, anticorps prxii, anticorps tdpx1, anticorps tpx1, anticorps peroxiredoxin 2, anticorps peroxiredoxin 2 L homeolog, anticorps PRDX2, anticorps Prdx2, anticorps prdx2.L
- Sujet
- PRDX2 is a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. It may play an antioxidant protective role in cells, and may contribute to the antiviral activity of CD8(+) T-cells. This protein may have a proliferative effect and play a role in cancer development or progression. The crystal structure of this protein has been resolved to 2.7 angstroms.
- Poids moléculaire
- 22 kDa (MW of target protein)
-