CNN2 anticorps (N-Term)

N° du produit ABIN630847

Détail du produit anti-CNN2 anticorps

Antigène: CNN2 (Calponin 2 (CNN2))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CNN2 est non-conjugé

Application: Western Blotting (WB)

Specificité: Calponin 2 antibody was raised against the N terminal of CNN2

Purification: Affinity purified

Immunogène: Calponin 2 antibody was raised using the N terminal of CNN2 corresponding to a region with amino acids YGLSAEVKNRLLSKYDPQKEAELRTWIEGLTGLSIGPDFQKGLKDGTILC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Calponin 2 Blocking Peptide, catalog no. 33R-10105, is also available for use as a blocking control in assays to test for specificity of this Calponin 2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CNN2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CNN2

Antigène: CNN2 (Calponin 2 (CNN2))

Autre désignation: Calponin 2 (CNN2 Produits)

Synonymes: anticorps Calponin-2, anticorps CNN2, anticorps DKFZp468N0916, anticorps cnn2, anticorps AA408047, anticorps AI324678, anticorps Calpo2, anticorps wu:fb36d03, anticorps wu:fb93a05, anticorps wz2414, anticorps zgc:65794, anticorps MGC82320, anticorps MGC108411, anticorps calponin 2, anticorps calponin 2 L homeolog, anticorps calponin 2 pseudogene, anticorps CNN2, anticorps cnn2, anticorps Cnn2, anticorps cnn2.L, anticorps LOC450419

Sujet: CNN2, which can bind actin, calmodulin, troponin C, and tropomyosin, may function in the structural organization of actin filaments. CNN2 could play a role in smooth muscle contraction and cell adhesion.

Poids moléculaire: 34 kDa (MW of target protein)