FKBP3 anticorps (C-Term)

N° du produit ABIN630860

Détail du produit anti-FKBP3 anticorps

Antigène: FKBP3 (FK506 Binding Protein 3, 25kDa (FKBP3))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FKBP3 est non-conjugé

Application: Western Blotting (WB)

Specificité: FKBP3 antibody was raised against the C terminal of FKBP3

Purification: Affinity purified

Immunogène: FKBP3 antibody was raised using the C terminal of FKBP3 corresponding to a region with amino acids EALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FKBP3 Blocking Peptide, catalog no. 33R-2266, is also available for use as a blocking control in assays to test for specificity of this FKBP3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FKBP3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FKBP3

Antigène: FKBP3 (FK506 Binding Protein 3, 25kDa (FKBP3))

Autre désignation: FKBP3 (FKBP3 Produits)

Synonymes: anticorps FKBP3, anticorps 25kDa, anticorps FKBP-3, anticorps FKBP25, anticorps FK506, anticorps fb75c04, anticorps si:dz261o22.2, anticorps wu:fb75c04, anticorps zgc:110728, anticorps FKBP-25, anticorps PPIase, anticorps FK506 binding protein 3, anticorps FK506 binding protein 3 L homeolog, anticorps peptidylprolyl isomerase, anticorps FKBP3, anticorps Fkbp3, anticorps fkbp3, anticorps fkbp3.L, anticorps CAALFM_C103790CA

Sujet: FKBP3 is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. FKBP3 is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin, as well as histone deacetylases, the transcription factor YY1, casein kinase II, and nucleolin. It has a higher affinity for rapamycin than for FK506 and thus may be an important target molecule for immunosuppression by rapamycin.

Poids moléculaire: 25 kDa (MW of target protein)