PHACTR3 anticorps (C-Term)
-
- Antigène Voir toutes PHACTR3 Anticorps
- PHACTR3 (Phosphatase and Actin Regulator 3 (PHACTR3))
-
Épitope
- C-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PHACTR3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PHACTR3 antibody was raised against the C terminal of PHACTR3
- Purification
- Affinity purified
- Immunogène
- PHACTR3 antibody was raised using the C terminal of PHACTR3 corresponding to a region with amino acids IEMKLSKRLSQRPAVEELERRNILKQRNDQTEQEERREIKQRLTRKLNQR
- Top Product
- Discover our top product PHACTR3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PHACTR3 Blocking Peptide, catalog no. 33R-3947, is also available for use as a blocking control in assays to test for specificity of this PHACTR3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PHACTR3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PHACTR3 (Phosphatase and Actin Regulator 3 (PHACTR3))
- Autre désignation
- PHACTR3 (PHACTR3 Produits)
- Synonymes
- anticorps C20orf101, anticorps H17739, anticorps SCAPIN1, anticorps SCAPININ, anticorps 1500003N10Rik, anticorps 4930415A02Rik, anticorps Scapin1, anticorps Scapinin, anticorps mKIAA4224, anticorps scapinin, anticorps h17739, anticorps scapin1, anticorps DKFZp459A1919, anticorps zgc:109967, anticorps zgc:172129, anticorps phosphatase and actin regulator 3, anticorps phosphatase and actin regulator 3 L homeolog, anticorps phosphatase and actin regulator 3b, anticorps phosphatase and actin regulator 3a, anticorps PHACTR3, anticorps Phactr3, anticorps phactr3.L, anticorps phactr3, anticorps LOC100543179, anticorps phactr3b, anticorps phactr3a
- Sujet
- PHACTR3 is associated with the nuclear scaffold in proliferating cells. It was found to bind to the catalytic subunit of protein phosphatase-1 (PP1) and inhibit PP1 activity, suggesting that this protein may function as a regulatory subunit of PP1.
- Poids moléculaire
- 51 kDa (MW of target protein)
-