PECI/ECI2 anticorps (Middle Region)

N° du produit ABIN630872

Détail du produit anti-PECI/ECI2 anticorps

Antigène: PECI/ECI2 (PECI) (Enoyl-CoA Delta Isomerase 2 (PECI))

Épitope: Middle Region

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PECI/ECI2 est non-conjugé

Application: Western Blotting (WB)

Specificité: PECI antibody was raised against the middle region of PECI

Purification: Affinity purified

Immunogène: PECI antibody was raised using the middle region of PECI corresponding to a region with amino acids AVGISVTLLGLFDAVYASDRATFHTPFSHLGQSPEGCSSYTFPKIMSPAK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PECI Blocking Peptide, catalog no. 33R-1595, is also available for use as a blocking control in assays to test for specificity of this PECI antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PECI antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PECI/ECI2

Antigène: PECI/ECI2 (PECI) (Enoyl-CoA Delta Isomerase 2 (PECI))

Autre désignation: PECI (PECI Produits)

Synonymes: anticorps PECI, anticorps ACBD2, anticorps DRS-1, anticorps DRS1, anticorps HCA88, anticorps dJ1013A10.3, anticorps Peci, anticorps Acbd2, anticorps Drs1, anticorps Hca88, anticorps ECI2, anticorps wu:fd61c12, anticorps enoyl-CoA delta isomerase 2, anticorps enoyl-Coenzyme A delta isomerase 2, anticorps peroxisomal D3,D2-enoyl-CoA isomerase, anticorps ECI2, anticorps Eci2, anticorps peci, anticorps eci2

Sujet: PECI is an auxiliary enzyme that catalyzes an isomerization step required for the beta-oxidation of unsaturated fatty acids.

Poids moléculaire: 40 kDa (MW of target protein)