PPIL2 anticorps
-
- Antigène Voir toutes PPIL2 Anticorps
- PPIL2 (Peptidylprolyl Isomerase (Cyclophilin)-Like 2 (PPIL2))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PPIL2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- PPIL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GRVVGGFDVLTAMENVESDPKTDRPKEEIRIDATTVFVDPYEEADAQIAQ
- Top Product
- Discover our top product PPIL2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PPIL2 Blocking Peptide, catalog no. 33R-3545, is also available for use as a blocking control in assays to test for specificity of this PPIL2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPIL2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PPIL2 (Peptidylprolyl Isomerase (Cyclophilin)-Like 2 (PPIL2))
- Autre désignation
- PPIL2 (PPIL2 Produits)
- Synonymes
- anticorps cyc4, anticorps cyp60, anticorps hcyp-60, anticorps CYC4, anticorps CYP60, anticorps Cyp-60, anticorps UBOX7, anticorps hCyP-60, anticorps 0610009L05Rik, anticorps 1700016N17Rik, anticorps 4921520K19Rik, anticorps 4930511F14Rik, anticorps AA589416, anticorps C130078A06Rik, anticorps si:dkeyp-86g2.1, anticorps zgc:56616, anticorps zgc:86735, anticorps peptidylprolyl isomerase like 2 S homeolog, anticorps peptidylprolyl isomerase like 2, anticorps peptidylprolyl isomerase (cyclophilin)-like 2, anticorps ppil2.S, anticorps PPIL2, anticorps ppil2, anticorps Ppil2
- Sujet
- PPIL2 is a member of the cyclophilin family of peptidylprolyl isomerases. The cyclophilins are a highly conserved ubiquitous family, members of which play an important role in protein folding, immunosuppression by cyclosporin A, and infection of HIV-1 virions.
- Poids moléculaire
- 59 kDa (MW of target protein)
-