GAPDH anticorps (Middle Region)
-
- Antigène Voir toutes GAPDH Anticorps
- GAPDH (Glyceraldehyde-3-Phosphate Dehydrogenase (GAPDH))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GAPDH est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- GAPDH antibody was raised against the middle region of GAPDH
- Purification
- Affinity purified
- Immunogène
- GAPDH antibody was raised using the middle region of GAPDH corresponding to a region with amino acids KAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNC
- Top Product
- Discover our top product GAPDH Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GAPDH Blocking Peptide, catalog no. 33R-4239, is also available for use as a blocking control in assays to test for specificity of this GAPDH antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GAPDH antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
Silica crystals and aluminum salts regulate the production of prostaglandin in macrophages via NALP3 inflammasome-independent mechanisms." dans: Immunity, Vol. 34, Issue 4, pp. 514-26, (2011) (PubMed).
: "ROCK1 plays an essential role in the transition from cardiac hypertrophy to failure in mice." dans: Journal of molecular and cellular cardiology, Vol. 49, Issue 5, pp. 819-28, (2010) (PubMed).
: "The reduction of voluntary physical activity after poly I:C injection is independent of the effect of poly I:C-induced interferon-beta in mice." dans: Physiology & behavior, Vol. 93, Issue 4-5, pp. 835-41, (2008) (PubMed).
: "
-
Silica crystals and aluminum salts regulate the production of prostaglandin in macrophages via NALP3 inflammasome-independent mechanisms." dans: Immunity, Vol. 34, Issue 4, pp. 514-26, (2011) (PubMed).
-
- Antigène
- GAPDH (Glyceraldehyde-3-Phosphate Dehydrogenase (GAPDH))
- Autre désignation
- GAPDH (GAPDH Produits)
- Synonymes
- anticorps G3PD, anticorps GAPD, anticorps Gapd, anticorps BEST:GH12586, anticorps CG12055, anticorps Dmel\\CG12055, anticorps GA3PDH, anticorps GADPH, anticorps GAP, anticorps GAPDH, anticorps GAPDH I, anticorps GAPDH-1, anticorps GAPDH1, anticorps GAPDHI, anticorps Gapdh, anticorps Gapdh-1, anticorps Gapdh43E, anticorps gadph, anticorps gapdh, anticorps gapdh-1, anticorps gh12586, anticorps cb609, anticorps gapd, anticorps mg:bb02e05, anticorps wu:fb33a10, anticorps wu:ft80f05, anticorps KNC-NDS6, anticorps g3pd, anticorps G3PDH, anticorps glyceraldehyde-3-phosphate dehydrogenase, anticorps Glyceraldehyde 3 phosphate dehydrogenase 1, anticorps glyceraldehyde-3-phosphate dehydrogenase S homeolog, anticorps glyceraldehyde-3-phosphate dehydrogenase, type I, anticorps olfactory receptor 8K3, anticorps GAPDH, anticorps Gapdh, anticorps Gapdh1, anticorps gapdh, anticorps gapdh.S, anticorps gapDH, anticorps LOC100404960, anticorps LOC614985
- Sujet
- GAPDH catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD).
- Poids moléculaire
- 36 kDa (MW of target protein)
-