MEMO1 anticorps (Middle Region)
-
- Antigène Voir toutes MEMO1 Anticorps
- MEMO1 (Mediator of Cell Motility 1 (MEMO1))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MEMO1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- MEMO1 antibody was raised against the middle region of MEMO1
- Purification
- Affinity purified
- Immunogène
- MEMO1 antibody was raised using the middle region of MEMO1 corresponding to a region with amino acids AMESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSNLFVVSSDFCH
- Top Product
- Discover our top product MEMO1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MEMO1 Blocking Peptide, catalog no. 33R-1386, is also available for use as a blocking control in assays to test for specificity of this MEMO1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MEMO1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MEMO1 (Mediator of Cell Motility 1 (MEMO1))
- Autre désignation
- MEMO1 (MEMO1 Produits)
- Synonymes
- anticorps MGC89105, anticorps C2orf4, anticorps MEMO, anticorps NS5ATP7, anticorps 0610016J10Rik, anticorps D930048L02Rik, anticorps RGD1309929, anticorps fi04d12, anticorps wu:fi04d12, anticorps zgc:55290, anticorps mediator of cell motility 1, anticorps mediator of cell motility 1 L homeolog, anticorps MEMO1, anticorps memo1, anticorps Memo1, anticorps memo1.L
- Sujet
- MEMO1 may control cell migration by relaying extracellular chemotactic signals to the microtubule cytoskeleton. MEMO1 is the mediator of ERBB2 signaling. MEMO1 is required for breast carcinoma cell migration.
- Poids moléculaire
- 34 kDa (MW of target protein)
-