PGK2 anticorps (C-Term)
-
- Antigène Voir toutes PGK2 Anticorps
- PGK2 (Phosphoglycerate Kinase 2 (PGK2))
-
Épitope
- C-Term
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PGK2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PGK2 antibody was raised against the C terminal of PGK2
- Purification
- Affinity purified
- Immunogène
- PGK2 antibody was raised using the C terminal of PGK2 corresponding to a region with amino acids ITVIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKILPGVEALSNM
- Top Product
- Discover our top product PGK2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PGK2 Blocking Peptide, catalog no. 33R-4189, is also available for use as a blocking control in assays to test for specificity of this PGK2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGK2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PGK2 (Phosphoglycerate Kinase 2 (PGK2))
- Autre désignation
- PGK2 (PGK2 Produits)
- Synonymes
- anticorps PGKB, anticorps PGKPS, anticorps dJ417L20.2, anticorps Pgk-2, anticorps Tcp-2, anticorps PGK2, anticorps phosphoglycerate kinase 2, anticorps PGK2, anticorps Pgk2, anticorps cbbK
- Sujet
- PGK2 is a testis-specific form of phosphoglycerate kinase (EC 2.7.2.3), which catalyzes the reversible conversion of 1,3-diphosphoglycerate to 3-phosphoglycerate during glycolysis, generating one molecule of ATP. The PGK2 gene encodes a testis-specific form of phosphoglycerate kinase (EC 2.7.2.3), which catalyzes the reversible conversion of 1,3-diphosphoglycerate to 3-phosphoglycerate during glycolysis, generating one molecule of ATP.
- Poids moléculaire
- 46 kDa (MW of target protein)
-