ALDOC anticorps (N-Term)
-
- Antigène Voir toutes ALDOC Anticorps
- ALDOC (Aldolase C, Fructose-Bisphosphate (ALDOC))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ALDOC est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ALDOC antibody was raised against the N terminal of ALDOC
- Purification
- Affinity purified
- Immunogène
- ALDOC antibody was raised using the N terminal of ALDOC corresponding to a region with amino acids MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVE
- Top Product
- Discover our top product ALDOC Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ALDOC Blocking Peptide, catalog no. 33R-6286, is also available for use as a blocking control in assays to test for specificity of this ALDOC antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALDOC antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ALDOC (Aldolase C, Fructose-Bisphosphate (ALDOC))
- Autre désignation
- ALDOC (ALDOC Produits)
- Synonymes
- anticorps ALDC, anticorps MGC69434, anticorps ALDOC, anticorps aldoc, anticorps AI847350, anticorps AU040929, anticorps Aldo3, anticorps Scrg2, anticorps ALDCAA, anticorps F16dip7, anticorps RATALDCAA, anticorps aldocl, anticorps wu:fj56h04, anticorps zgc:112357, anticorps QccE-21970, anticorps aldolase, fructose-bisphosphate C, anticorps aldolase, fructose-bisphosphate C L homeolog, anticorps aldolase C, fructose-bisphosphate, b, anticorps aldolase C, fructose-bisphosphate, anticorps aldolase A, fructose-bisphosphate, anticorps aldolase C, fructose-bisphosphate, a, anticorps Fructose-bisphosphate aldolase C, anticorps ALDOC, anticorps aldoc.L, anticorps aldoc, anticorps aldocb, anticorps Aldoc, anticorps ALDOA, anticorps aldoca
- Sujet
- ALDOC gene is a member of the class I fructose-biphosphate aldolase gene family. ALDOC is a glycolytic enzyme that catalyzes the reversible aldol cleavage of fructose-1,6-biphosphate and fructose 1-phosphate to dihydroxyacetone phosphate and either glyceraldehyde-3-phosphate or glyceraldehyde, respectively.
- Poids moléculaire
- 39 kDa (MW of target protein)
-