SULT1B1 anticorps (N-Term)

N° du produit ABIN630908

Détail du produit anti-SULT1B1 anticorps

Antigène: SULT1B1 (Sulfotransferase Family 1B Member 1 (SULT1B1))

Épitope: N-Term

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SULT1B1 est non-conjugé

Application: Western Blotting (WB)

Specificité: SULT1 B1 antibody was raised against the N terminal of SULT1 1

Purification: Affinity purified

Immunogène: SULT1 B1 antibody was raised using the N terminal of SULT1 1 corresponding to a region with amino acids KRGFITEKVPMLEMTLPGLRTSGIEQLEKNPSPRIVKTHLPTDLLPKSFW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SULT1B1 Blocking Peptide, catalog no. 33R-4623, is also available for use as a blocking control in assays to test for specificity of this SULT1B1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SULT0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SULT1B1

Antigène: SULT1B1 (Sulfotransferase Family 1B Member 1 (SULT1B1))

Autre désignation: SULT1B1 (SULT1B1 Produits)

Synonymes: anticorps ST1B1, anticorps ST1B2, anticorps SULT1B2, anticorps St2b2, anticorps SULT1B, anticorps cSULT1B1, anticorps MGC80677, anticorps SULT1B1, anticorps sulfotransferase family 1B member 1, anticorps sulfotransferase family 1B, member 1, anticorps sulfotransferase family cytosolic 1B member 1, anticorps sulfotransferase family 1B member 1 S homeolog, anticorps sulfotransferase family, cytosolic, 1B, member 1, anticorps SULT1B1, anticorps Sult1b1, anticorps sult1b1.S, anticorps sult1b1, anticorps LOC100624541

Sujet: SULT1B1 Catalyzes the sulfate conjugation of many hormones, neurotransmitters, drugs and xenobiotic compounds. Sulfonation increases the water solubility of most compounds, and therefore their renal excretion, but it can also result in bioactivation to form active metabolites. Sulfates dopamine, small phenols such as 1-naphthol and p-nitrophenol and thyroid hormones, including 3,3'-diiodothyronine, triidothyronine, reverse triiodothyronine and thyroxine.

Poids moléculaire: 35 kDa (MW of target protein)