Transglutaminase 7 anticorps (C-Term)

N° du produit ABIN630909

Détail du produit anti-Transglutaminase 7 anticorps

Antigène: Transglutaminase 7 (TGM7)

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Transglutaminase 7 est non-conjugé

Application: Western Blotting (WB)

Specificité: Transglutaminase 7 antibody was raised against the C terminal of TGM7

Purification: Affinity purified

Immunogène: Transglutaminase 7 antibody was raised using the C terminal of TGM7 corresponding to a region with amino acids TQKPFWRHTVRMNLDFGKETQWPLLLPYSNYRNKLTDEKLIRVSGIAEVE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Transglutaminase 7 Blocking Peptide, catalog no. 33R-9245, is also available for use as a blocking control in assays to test for specificity of this Transglutaminase 7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TGM7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Transglutaminase 7

Antigène: Transglutaminase 7 (TGM7)

Autre désignation: Transglutaminase 7 (TGM7 Produits)

Synonymes: anticorps TGMZ, anticorps TGM7, anticorps TGz, anticorps transglutaminase 7, anticorps TGM7, anticorps Tgm7

Sujet: Transglutaminases (TGM, EC 2.3.2.13) are a family of structurally and functionally related enzymes that stabilize protein assemblies through the formation of gamma-glutamyl-epsilonlysine crosslinks. Transglutaminases (TGM, EC 2.3.2.13) are a family of structurally and functionally related enzymes that stabilize protein assemblies through the formation of gamma-glutamyl-epsilon lysine crosslinks.

Poids moléculaire: 80 kDa (MW of target protein)