GSTO2 anticorps (N-Term)

N° du produit ABIN630910

Détail du produit anti-GSTO2 anticorps

Antigène: GSTO2 (Glutathione S-Transferase omega 2 (GSTO2))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GSTO2 est non-conjugé

Application: Western Blotting (WB)

Specificité: GSTO2 antibody was raised against the N terminal of GSTO2

Purification: Affinity purified

Immunogène: GSTO2 antibody was raised using the N terminal of GSTO2 corresponding to a region with amino acids VLETSQCQLIYESVIACEYLDDAYPGRKLFPYDPYERARQKMLLELFCKV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GSTO2 Blocking Peptide, catalog no. 33R-9654, is also available for use as a blocking control in assays to test for specificity of this GSTO2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GSTO2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GSTO2

Antigène: GSTO2 (Glutathione S-Transferase omega 2 (GSTO2))

Autre désignation: GSTO2 (GSTO2 Produits)

Synonymes: anticorps GSTO 2-2, anticorps bA127L20.1, anticorps 1700020F09Rik, anticorps 4930425C18Rik, anticorps glutathione S-transferase omega 2, anticorps GSTO2, anticorps Gsto2

Sujet: The omega class glutathione transferases (GST, EC 2.5.1.18) have poor activity with common GST substrates, but exhibit novel glutathione-dependent thioltransferase, dehydroascorbate reductase, and monomethylarsonate reductase activities, and they modulate Ca(2+) release by ryanodine receptors (e.g., RYR1).

Poids moléculaire: 28 kDa (MW of target protein)