PSMD8 anticorps
-
- Antigène Voir toutes PSMD8 Anticorps
- PSMD8 (Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 8 (PSMD8))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PSMD8 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- PSMD8 antibody was raised using a synthetic peptide corresponding to a region with amino acids DYAKKRGWVLGPNNYYSFASQQQKPEDTTIPSTELAKQVIEYARQLEMIV
- Top Product
- Discover our top product PSMD8 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PSMD8 Blocking Peptide, catalog no. 33R-2234, is also available for use as a blocking control in assays to test for specificity of this PSMD8 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMD8 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PSMD8 (Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 8 (PSMD8))
- Autre désignation
- PSMD8 (PSMD8 Produits)
- Synonymes
- anticorps HIP6, anticorps HYPF, anticorps Nin1p, anticorps Rpn12, anticorps S14, anticorps p31, anticorps hip6, anticorps hypf, anticorps nin1p, anticorps rpn12, anticorps psmd8b, anticorps 6720456J22Rik, anticorps AA407360, anticorps AL033291, anticorps AL033322, anticorps AL033323, anticorps C76433, anticorps psmd8, anticorps psmd8a, anticorps fa93g07, anticorps fb17c09, anticorps fb49a10, anticorps zgc:86762, anticorps wu:fa93g07, anticorps wu:fb17c09, anticorps wu:fb49a10, anticorps PSMD8, anticorps proteasome 26S subunit, non-ATPase 8, anticorps proteasome 26S subunit, non-ATPase 8 S homeolog, anticorps proteasome (prosome, macropain) 26S subunit, non-ATPase, 8, anticorps proteasome 26S subunit, non-ATPase 8 L homeolog, anticorps proteasome (prosome, macropain) 26S subunit, non-ATPase, 8 pseudogene, anticorps PSMD8, anticorps psmd8.S, anticorps Psmd8, anticorps psmd8.L, anticorps psmd8, anticorps LOC468490
- Sujet
- The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. PSMD8 is a non-ATPase subunit of the 19S regulator. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides.
- Poids moléculaire
- 27 kDa (MW of target protein)
- Pathways
- Mitotic G1-G1/S Phases, DNA Replication, Proton Transport, Synthesis of DNA, SARS-CoV-2 Protein Interactome, Ubiquitin Proteasome Pathway
-