PSMB5 anticorps
-
- Antigène Voir toutes PSMB5 Anticorps
- PSMB5 (Proteasome (Prosome, Macropain) Subunit, beta Type, 5 (PSMB5))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PSMB5 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- PSMB5 antibody was raised using a synthetic peptide corresponding to a region with amino acids IVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQ
- Top Product
- Discover our top product PSMB5 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PSMB5 Blocking Peptide, catalog no. 33R-4193, is also available for use as a blocking control in assays to test for specificity of this PSMB5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMB5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PSMB5 (Proteasome (Prosome, Macropain) Subunit, beta Type, 5 (PSMB5))
- Autre désignation
- PSMB5 (PSMB5 Produits)
- Synonymes
- anticorps LMPX, anticorps MB1, anticorps X, anticorps etID309919.2, anticorps fb59c07, anticorps si:zc14a17.13, anticorps wu:fb59c07, anticorps x, anticorps zgc:86820, anticorps proteasome subunit beta 5, anticorps proteasome (prosome, macropain) subunit, beta type 5, anticorps proteasome subunit beta 5 L homeolog, anticorps proteasome (prosome, macropain) subunit, beta type, 5, anticorps PSMB5, anticorps psmb5, anticorps Psmb5, anticorps psmb5.L
- Sujet
- The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. PSMB5 is a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit in the proteasome.
- Poids moléculaire
- 28 kDa (MW of target protein)
- Pathways
- Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA
-