CAMLG anticorps (N-Term)

N° du produit ABIN630925

Détail du produit anti-CAMLG anticorps

Antigène: CAMLG (Calcium Modulating Ligand (CAMLG))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CAMLG est non-conjugé

Application: Western Blotting (WB)

Specificité: CAMLG antibody was raised against the N terminal of CAMLG

Purification: Affinity purified

Immunogène: CAMLG antibody was raised using the N terminal of CAMLG corresponding to a region with amino acids LLMNSEQRINRIMGFHRPGSGAEEESQTKSKQQDSDKLNSLSVPSVSKRV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CAMLG Blocking Peptide, catalog no. 33R-5170, is also available for use as a blocking control in assays to test for specificity of this CAMLG antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAMLG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CAMLG

Antigène: CAMLG (Calcium Modulating Ligand (CAMLG))

Autre désignation: CAMLG (CAMLG Produits)

Synonymes: anticorps MGC53900, anticorps CAML, anticorps AI385748, anticorps Camlg, anticorps Caml, anticorps calcium modulating ligand L homeolog, anticorps calcium modulating ligand, anticorps camlg.L, anticorps CAMLG, anticorps camlg, anticorps Caml, anticorps Camlg

Sujet: The immunosuppressant drug cyclosporin A blocks a calcium-dependent signal from the T-cell receptor (TCR) that normally leads to T-cell activation. When bound to cyclophilin B, cyclosporin A binds and inactivates the key signaling intermediate calcineurin. CAMLG functions similarly to cyclosporin A, binding to cyclophilin B and acting downstream of the TCR and upstream of calcineurin by causing an influx of calcium. This integral membrane protein appears to be a new participant in the calcium signal transduction pathway, implicating cyclophilin B in calcium signaling, even in the absence of cyclosporin.

Poids moléculaire: 33 kDa (MW of target protein)

Pathways: EGFR Signaling Pathway