Gasdermin B anticorps (N-Term)

N° du produit ABIN630929

Détail du produit anti-Gasdermin B anticorps

Antigène: Gasdermin B (GSDMB)

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Gasdermin B est non-conjugé

Application: Western Blotting (WB)

Specificité: GSDML antibody was raised against the N terminal of GSDML

Purification: Affinity purified

Immunogène: GSDML antibody was raised using the N terminal of GSDML corresponding to a region with amino acids HLVGEKRTFFGCRHYTTGLTLMDILDTDGDKWLDELDSGLQGQKAEFQIL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GSDML Blocking Peptide, catalog no. 33R-3791, is also available for use as a blocking control in assays to test for specificity of this GSDML antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GSDML antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Gasdermin B

Antigène: Gasdermin B (GSDMB)

Autre désignation: GSDML (GSDMB Produits)

Synonymes: anticorps GSDML, anticorps PRO2521, anticorps gasdermin B, anticorps GSDMB

Sujet: GSDML belongs to the gasdermin family.GSDML may play a role as secretory or metabolic product involved in secretory pathway. It may also play a role in achieving and maintaining the final differentiation state of epithelial cells.

Poids moléculaire: 45 kDa (MW of target protein)