MAP3K1 anticorps (C-Term)

N° du produit ABIN630931

Détail du produit anti-MAP3K1 anticorps

Antigène: MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1 (MAP3K1))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MAP3K1 est non-conjugé

Application: Western Blotting (WB)

Specificité: MAP3 K1 antibody was raised against the C terminal of MAP3 1

Purification: Affinity purified

Immunogène: MAP3 K1 antibody was raised using the C terminal of MAP3 1 corresponding to a region with amino acids LGAFSSCYQAQDVGTGTLMAVKQVTYVRNTSSEQEEVVEALREEIRMMSH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MAP3K1 Blocking Peptide, catalog no. 33R-4960, is also available for use as a blocking control in assays to test for specificity of this MAP3K1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAP0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MAP3K1

Antigène: MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1 (MAP3K1))

Autre désignation: MAP3K1 (MAP3K1 Produits)

Synonymes: anticorps MAP3K1, anticorps Mekk1, anticorps MAPKKK1, anticorps MEKK1, anticorps Mekk, anticorps ARAKIN, anticorps ATMEKK1, anticorps MAPK/ERK kinase kinase 1, anticorps MAPKKK8, anticorps T15F16.5, anticorps T15F16_5, anticorps MEKK, anticorps MEKK 1, anticorps SRXY6, anticorps mitogen-activated protein kinase kinase kinase 1, anticorps mitogen-activated protein kinase kinase kinase 1, E3 ubiquitin protein ligase, anticorps MAPK/ERK kinase kinase 1, anticorps MAP3K1, anticorps map3k1, anticorps Map3k1, anticorps MEKK1

Sujet: MAP3K, or MEK kinase, is a serine/threonine kinase that occupies a pivotal role in a network of phosphorylating enzymes integrating cellular responses to a number of mitogenic and metabolic stimuli, including insulin and many growth factors.

Poids moléculaire: 164 kDa (MW of target protein)

Pathways: Signalisation MAPK, Interferon-gamma Pathway, Caspase Cascade in Apoptosis, Signalisation TLR, Fc-epsilon Receptor Signaling Pathway, Activation of Innate immune Response, Regulation of Actin Filament Polymerization, Toll-Like Receptors Cascades