LASP1 anticorps (C-Term)

N° du produit ABIN630939

Détail du produit anti-LASP1 anticorps

Antigène: LASP1 (LIM and SH3 Protein 1 (LASP1))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LASP1 est non-conjugé

Application: Western Blotting (WB)

Specificité: LASP1 antibody was raised against the C terminal of LASP1

Purification: Affinity purified

Immunogène: LASP1 antibody was raised using the C terminal of LASP1 corresponding to a region with amino acids SYGGYKEPAAPVSIQRSAPGGGGKRYRAVYDYSAADEDEVSFQDGDTIVN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LASP1 Blocking Peptide, catalog no. 33R-8949, is also available for use as a blocking control in assays to test for specificity of this LASP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LASP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LASP1

Antigène: LASP1 (LIM and SH3 Protein 1 (LASP1))

Autre désignation: LASP1 (LASP1 Produits)

Synonymes: anticorps lasp1, anticorps MGC53336, anticorps LASP1, anticorps MGC89667, anticorps Lasp-1, anticorps MLN50, anticorps AA408629, anticorps Def-4, anticorps SH3P6, anticorps Tg(Col1a1-lacZ)1Ngma, anticorps fb92f05, anticorps wu:fb92f05, anticorps zgc:77542, anticorps lasp-1, anticorps mln50, anticorps LIM and SH3 protein 1, anticorps LIM and SH3 protein 1 L homeolog, anticorps lasp1, anticorps lasp1.L, anticorps LASP1, anticorps Lasp1

Sujet: LASP1 is a member of a LIM protein subfamily characterized by a LIM motif and a domain of Src homology region 3. It functions as an actin-binding protein and possibly in cytoskeletal organization.

Poids moléculaire: 30 kDa (MW of target protein)