SPAG8 anticorps (Middle Region)
-
- Antigène Voir toutes SPAG8 Anticorps
- SPAG8 (Sperm Associated Antigen 8 (SPAG8))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SPAG8 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SPAG8 antibody was raised against the middle region of SPAG8
- Purification
- Affinity purified
- Immunogène
- SPAG8 antibody was raised using the middle region of SPAG8 corresponding to a region with amino acids PAPTKPHDYRQEQPETFWIQRAPQLPTWWPLPTQVPAAEDYLTWKEWGFT
- Top Product
- Discover our top product SPAG8 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SPAG8 Blocking Peptide, catalog no. 33R-6974, is also available for use as a blocking control in assays to test for specificity of this SPAG8 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPAG8 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SPAG8 (Sperm Associated Antigen 8 (SPAG8))
- Autre désignation
- SPAG8 (SPAG8 Produits)
- Synonymes
- anticorps BS-84, anticorps HSD-1, anticorps SMP1, anticorps SPAG3, anticorps hSMP-1, anticorps MH-SPAG8, anticorps sperm associated antigen 8, anticorps SPAG8, anticorps Spag8
- Sujet
- The correlation of anti-sperm antibodies with cases of unexplained infertility implicates a role for these antibodies in blocking fertilization. Improved diagnosis and treatment of immunologic infertility, as well as identification of proteins for targeted contraception, are dependent on the identification and characterization of relevant sperm antigens. SPAG8 is recognised by sperm agglutinating antibodies from an infertile woman. This protein is localized in germ cells of the testis at all stages of spermatogenesis and is localized to the acrosomal region of mature spermatozoa.
- Poids moléculaire
- 53 kDa (MW of target protein)
-