PDE1C anticorps (N-Term)

N° du produit ABIN630963

Détail du produit anti-PDE1C anticorps

Antigène: PDE1C (phosphodiesterase 1C, Calmodulin-Dependent 70kDa (PDE1C))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PDE1C est non-conjugé

Application: Western Blotting (WB)

Specificité: PDE1 C antibody was raised against the N terminal of PDE1

Purification: Affinity purified

Immunogène: PDE1 C antibody was raised using the N terminal of PDE1 corresponding to a region with amino acids DLKKNIEYAASVLEAVYIDETRRLLDTEDELSDIQTDSVPSEVRDWLAST

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PDE1C Blocking Peptide, catalog no. 33R-2051, is also available for use as a blocking control in assays to test for specificity of this PDE1C antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDE0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PDE1C

Antigène: PDE1C (phosphodiesterase 1C, Calmodulin-Dependent 70kDa (PDE1C))

Autre désignation: PDE1C (PDE1C Produits)

Synonymes: anticorps CG14940, anticorps CG14942, anticorps CG14943, anticorps CG14944, anticorps CG31757, anticorps CG31758, anticorps CG42325, anticorps CG44007, anticorps Dmel\\CG44007, anticorps Dmel_CG14940, anticorps Dmel_CG14943, anticorps Dmel_CG14944, anticorps Dmel_CG31757, anticorps Dmel_CG31758, anticorps Dmel_CG42325, anticorps PDE1C, anticorps PDE1c, anticorps GB13690, anticorps Hcam3, anticorps Phosphodiesterase 1c, anticorps phosphodiesterase 1C, anticorps calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A, anticorps calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1C, anticorps phosphodiesterase 1C, calmodulin-dependent b, anticorps Pde1c, anticorps PDE1C, anticorps LOC724389, anticorps LOC100019026, anticorps pde1cb

Sujet: PDE1A belongs to the cyclic nucleotide phosphodiesterase family. It has a higher affinity for cGMP than for cAMP. The exact function of PDE1A remains unknown.

Poids moléculaire: 59 kDa (MW of target protein)

Pathways: EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Negative Regulation of Hormone Secretion, cAMP Metabolic Process, G-protein mediated Events, Interaction of EGFR with phospholipase C-gamma