PRODH2 anticorps

N° du produit ABIN630971

Détail du produit anti-PRODH2 anticorps

Antigène: PRODH2 (Proline Dehydrogenase (Oxidase) 2 (PRODH2))

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PRODH2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Affinity purified

Immunogène: PRODH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LGIPLDGTVCFGQLLGMCDHVSLALGQAGYVVYKSIPYGSLEEVIPYLIR

Information d'application

Indications d'application: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PRODH2 Blocking Peptide, catalog no. 33R-4976, is also available for use as a blocking control in assays to test for specificity of this PRODH2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRODH2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PRODH2

Antigène: PRODH2 (Proline Dehydrogenase (Oxidase) 2 (PRODH2))

Autre désignation: PRODH2 (PRODH2 Produits)

Synonymes: anticorps HSPOX1, anticorps 2510028N04Rik, anticorps 2510038B11Rik, anticorps MmPOX, anticorps MmPOX1, anticorps POX1, anticorps proline dehydrogenase 2, anticorps proline dehydrogenase (oxidase) 2 L homeolog, anticorps proline dehydrogenase (oxidase) 2, anticorps PRODH2, anticorps prodh2.L, anticorps Prodh2

Sujet: PRODH2 is similar to proline dehydrogenase (oxidase) 1, a mitochondrial enzyme which catalyzes the first step in proline catabolism. The function of this protein has not been determined.

Poids moléculaire: 59 kDa (MW of target protein)