DLGAP5 anticorps (N-Term)

N° du produit ABIN630974

Détail du produit anti-DLGAP5 anticorps

Antigène: DLGAP5 (Discs, Large (Drosophila) Homolog-Associated Protein 5 (DLGAP5))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DLGAP5 est non-conjugé

Application: Western Blotting (WB)

Specificité: DLG7 antibody was raised against the N terminal Of Dlg7

Purification: Affinity purified

Immunogène: DLG7 antibody was raised using the N terminal Of Dlg7 corresponding to a region with amino acids EYERNRHFGLKDVNIPTLEGRILVELDETSQELVPEKTNVKPRAMKTILG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DLG7 Blocking Peptide, catalog no. 33R-2820, is also available for use as a blocking control in assays to test for specificity of this DLG7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLG7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DLGAP5

Antigène: DLGAP5 (Discs, Large (Drosophila) Homolog-Associated Protein 5 (DLGAP5))

Autre désignation: DLG7 (DLGAP5 Produits)

Synonymes: anticorps DLG7, anticorps dlg7, anticorps sb:cb647, anticorps zgc:92146, anticorps wu:fc96g08, anticorps wu:fe11c02, anticorps HURP, anticorps C77459, anticorps C86398, anticorps Dap-5, anticorps Dlg7, anticorps Hurp, anticorps mKIAA0008, anticorps DLG associated protein 5, anticorps discs, large (Drosophila) homolog-associated protein 5, anticorps DLGAP5, anticorps dlgap5, anticorps Dlgap5

Sujet: DLG7 is a potential cell cycle regulator that may play a role in carcinogenesis of cancer cells. It is a mitotic phosphoprotein regulated by the ubiquitin-proteasome pathway. DLG7 is the key regulator of adherens junction integrity and differentiation that may be involved in CDH1-mediated adhesion and signaling in epithelial cells.

Poids moléculaire: 95 kDa (MW of target protein)

Pathways: M Phase