GCDH anticorps (N-Term)

N° du produit ABIN630975

Détail du produit anti-GCDH anticorps

Antigène: GCDH (Glutaryl-CoA Dehydrogenase (GCDH))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GCDH est non-conjugé

Application: Western Blotting (WB)

Specificité: GCDH antibody was raised against the N terminal of GCDH

Purification: Affinity purified

Immunogène: GCDH antibody was raised using the N terminal of GCDH corresponding to a region with amino acids SLVMHPIYAYGSEEQRQKYLPQLAKGELLGCFGLTEPNSGSDPSSMETRA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GCDH Blocking Peptide, catalog no. 33R-8632, is also available for use as a blocking control in assays to test for specificity of this GCDH antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GCDH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GCDH

Antigène: GCDH (Glutaryl-CoA Dehydrogenase (GCDH))

Autre désignation: GCDH (GCDH Produits)

Synonymes: anticorps ACAD5, anticorps GCD, anticorps zgc:56505, anticorps zgc:77704, anticorps 9030411L18, anticorps AI266902, anticorps D17825, anticorps glutaryl-CoA dehydrogenase, anticorps glutaryl-CoA dehydrogenase a, anticorps glutaryl-Coenzyme A dehydrogenase, anticorps GCDH, anticorps Gcdh, anticorps gcdha

Sujet: GCDH belongs to the acyl-CoA dehydrogenase family. It catalyzes the oxidative decarboxylation of glutaryl-CoA to crotonyl-CoA and CO(2) in the degradative pathway of L-lysine, L-hydroxylysine, and L-tryptophan metabolism. It uses electron transfer flavoprotein as its electron acceptor. The enzyme exists in the mitochondrial matrix as a homotetramer of 45 kDa subunits.

Poids moléculaire: 43 kDa (MW of target protein)