CDT2/RAMP anticorps
-
- Antigène Voir toutes CDT2/RAMP (DTL) Anticorps
- CDT2/RAMP (DTL) (Denticleless E3 Ubiquitin Protein Ligase Homolog (DTL))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CDT2/RAMP est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- DTL antibody was raised using a synthetic peptide corresponding to a region with amino acids VNQISGAHNTSDKQTPSKPKKKQNSKGLAPSVDFQQSVTVVLFQDENTLV
- Top Product
- Discover our top product DTL Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
DTL Blocking Peptide, catalog no. 33R-9712, is also available for use as a blocking control in assays to test for specificity of this DTL antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DTL antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CDT2/RAMP (DTL) (Denticleless E3 Ubiquitin Protein Ligase Homolog (DTL))
- Autre désignation
- DTL (DTL Produits)
- Synonymes
- anticorps CDT2, anticorps DCAF2, anticorps L2DTL, anticorps RAMP, anticorps 2810047L02Rik, anticorps 5730564G15Rik, anticorps Ramp, anticorps RGD1310439, anticorps cdt2, anticorps cdt2-a, anticorps dcaf2, anticorps l2dtl, anticorps ramp, anticorps cb151, anticorps chunp6871, anticorps wu:fb54b02, anticorps denticleless E3 ubiquitin protein ligase homolog, anticorps denticleless E3 ubiquitin protein ligase, anticorps denticleless E3 ubiquitin protein ligase homolog S homeolog, anticorps denticleless E3 ubiquitin protein ligase homolog (Drosophila), anticorps DTL, anticorps Dtl, anticorps dtl.S, anticorps dtl
- Sujet
- DTL is required for CDT1 proteolysis in response to DNA damage through the CUL4-DDB1 E3 ubiquitin-protein ligase. It seems to be necessary to ensure proper cell cycle regulation of DNA replication. DTL may function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex. It also may play a role in cell proliferation of NT2 embryonal carcinoma cells.
- Poids moléculaire
- 79 kDa (MW of target protein)
-