WBP11 anticorps (N-Term)

N° du produit ABIN630981

Détail du produit anti-WBP11 anticorps

Antigène: WBP11 (WW Domain Binding Protein 11 (WBP11))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp WBP11 est non-conjugé

Application: Western Blotting (WB)

Specificité: WBP11 antibody was raised against the N terminal of WBP11

Purification: Affinity purified

Immunogène: WBP11 antibody was raised using the N terminal of WBP11 corresponding to a region with amino acids GRRSTSSTKSGKFMNPTDQARKEARKRELKKNKKQRMMVRAAVLKMKDPK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

WBP11 Blocking Peptide, catalog no. 33R-3541, is also available for use as a blocking control in assays to test for specificity of this WBP11 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WBP11 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur WBP11

Antigène: WBP11 (WW Domain Binding Protein 11 (WBP11))

Autre désignation: WBP11 (WBP11 Produits)

Synonymes: anticorps 2510026P17Rik, anticorps D6Wsu113e, anticorps Npwbp, anticorps SIPP1, anticorps MGC69268, anticorps SNP70, anticorps zgc:77390, anticorps NPWBP, anticorps WBP-11, anticorps WW domain binding protein 11, anticorps WW domain binding protein 11 S homeolog, anticorps Wbp11, anticorps WBP11, anticorps wbp11.S, anticorps wbp11, anticorps Tsp_13063

Sujet: WBP11 is a nuclear protein, which colocalizes with mRNA splicing factors and intermediate filament-containing perinuclear networks. WBP11has 95% amino acid sequence identity to the mouse Wbp11 protein. It contains two proline-rich regions that bind to the WW domain of Npw38, a nuclear protein, and thus this protein is also called Npw38-binding protein NpwBP. The Npw38-NpwBP complex may function as a component of an mRNA factory in the nucleus.

Poids moléculaire: 70 kDa (MW of target protein)