MRPL15 anticorps (C-Term)

N° du produit ABIN630982

Détail du produit anti-MRPL15 anticorps

Antigène: MRPL15 (Mitochondrial Ribosomal Protein L15 (MRPL15))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MRPL15 est non-conjugé

Application: Western Blotting (WB)

Specificité: MRPL15 antibody was raised against the C terminal of MRPL15

Purification: Affinity purified

Immunogène: MRPL15 antibody was raised using the C terminal of MRPL15 corresponding to a region with amino acids KDELFKMLCTRKDPRQIFFGLAPGWVVNMADKKILKPTDENLLKYYTS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MRPL15 Blocking Peptide, catalog no. 33R-4283, is also available for use as a blocking control in assays to test for specificity of this MRPL15 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MRPL15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MRPL15

Antigène: MRPL15 (Mitochondrial Ribosomal Protein L15 (MRPL15))

Autre désignation: MRPL15 (MRPL15 Produits)

Synonymes: anticorps L15mt, anticorps MRP-L15, anticorps MRP-L7, anticorps RPML7, anticorps HSPC145, anticorps Rpml7, anticorps zgc:92856, anticorps mitochondrial ribosomal protein L15, anticorps mitochondrial ribosomal protein L15 L homeolog, anticorps MRPL15, anticorps Mrpl15, anticorps mrpl15, anticorps mrpl15.L

Sujet: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. MRPL15 belongs to the ribosomal protein L15P family. It is a 39S subunit protein that belongs to the EcoL15 ribosomal protein family.

Poids moléculaire: 33 kDa (MW of target protein)