MRPL39 anticorps (N-Term)
-
- Antigène Voir toutes MRPL39 Anticorps
- MRPL39 (Mitochondrial Ribosomal Protein L39 (MRPL39))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MRPL39 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- MRPL39 antibody was raised against the N terminal of MRPL39
- Purification
- Affinity purified
- Immunogène
- MRPL39 antibody was raised using the N terminal of MRPL39 corresponding to a region with amino acids TELTEMRNDLFNKEKARQLSLTPRTEKIEVKHVGKTDPGTVFVMNKNIST
- Top Product
- Discover our top product MRPL39 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MRPL39 Blocking Peptide, catalog no. 33R-9047, is also available for use as a blocking control in assays to test for specificity of this MRPL39 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MRPL39 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MRPL39 (Mitochondrial Ribosomal Protein L39 (MRPL39))
- Autre désignation
- MRPL39 (MRPL39 Produits)
- Synonymes
- anticorps CG17166, anticorps Dmel\\CG17166, anticorps MRP-L5, anticorps mRpL5, anticorps C21orf92, anticorps L39mt, anticorps MRPL5, anticorps PRED22, anticorps PRED66, anticorps RPML5, anticorps C21orf8, anticorps ORF22, anticorps Rpml5, anticorps mitochondrial ribosomal protein L39, anticorps mitochondrial ribosomal protein L39 L homeolog, anticorps mRpL39, anticorps mrpl39.L, anticorps MRPL39, anticorps Mrpl39
- Sujet
- Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. MRPL39 is a 39S subunit protein. Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion.
- Poids moléculaire
- 39 kDa (MW of target protein)
-