OXSM anticorps (Middle Region)
-
- Antigène Voir toutes OXSM Anticorps
- OXSM (3-Oxoacyl-ACP Synthase, Mitochondrial (OXSM))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp OXSM est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- OXSM antibody was raised against the middle region of OXSM
- Purification
- Affinity purified
- Immunogène
- OXSM antibody was raised using the middle region of OXSM corresponding to a region with amino acids HAVQRRARIYAEVLGYGLSGDAGHITAPDPEGEGALRCMAAALKDAGVQP
- Top Product
- Discover our top product OXSM Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
OXSM Blocking Peptide, catalog no. 33R-3696, is also available for use as a blocking control in assays to test for specificity of this OXSM antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OXSM antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- OXSM (3-Oxoacyl-ACP Synthase, Mitochondrial (OXSM))
- Autre désignation
- OXSM (OXSM Produits)
- Synonymes
- anticorps FASN2D, anticorps KASI, anticorps KS, anticorps 4933425A18Rik, anticorps C80494, anticorps RGD1311092, anticorps fatty acid synthase, anticorps 3-oxoacyl-ACP synthase, mitochondrial, anticorps FASN, anticorps OXSM, anticorps oxsm, anticorps Oxsm
- Sujet
- OXSM is a mitochondrial beta-ketoacyl synthase (EC 2.3.1.41) involved in mitochondrial fatty acid synthesis. It is required for catalysis of the chain-elongating condensation reaction.
- Poids moléculaire
- 49 kDa (MW of target protein)
-