WARS2 anticorps (Middle Region)
-
- Antigène Voir toutes WARS2 Anticorps
- WARS2 (Tryptophanyl tRNA Synthetase 2, Mitochondrial (WARS2))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp WARS2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- WARS2 antibody was raised against the middle region of WARS2
- Purification
- Affinity purified
- Immunogène
- WARS2 antibody was raised using the middle region of WARS2 corresponding to a region with amino acids TTKQKHDGTVGLLTYPVLQAADILLYKSTHVPVGEDQVQHMELVQDLAQG
- Top Product
- Discover our top product WARS2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
WARS2 Blocking Peptide, catalog no. 33R-9322, is also available for use as a blocking control in assays to test for specificity of this WARS2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WARS2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- WARS2 (Tryptophanyl tRNA Synthetase 2, Mitochondrial (WARS2))
- Autre désignation
- WARS2 (WARS2 Produits)
- Synonymes
- anticorps 5730427B17Rik, anticorps 9430020O07Rik, anticorps AI413375, anticorps TrpRS, anticorps zgc:110828, anticorps tryptophanyl tRNA synthetase 2, mitochondrial, anticorps tryptophanyl tRNA synthetase 2 (mitochondrial), anticorps WARS2, anticorps Wars2, anticorps wars2
- Sujet
- Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Two forms of tryptophanyl-tRNA synthetase exist, a cytoplasmic form, named WARS, and a mitochondrial form, named WARS2. WARS2 is the mitochondrial tryptophanyl-tRNA synthetase.
- Poids moléculaire
- 24 kDa (MW of target protein)
-