TBC1D1 anticorps
-
- Antigène Voir toutes TBC1D1 Anticorps
- TBC1D1 (TBC1 (Tre-2/USP6, BUB2, Cdc16) Domain Family, Member 1 (TBC1D1))
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TBC1D1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- TBC1 D1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RGSPGVSQRKLMRYHSVSTETPHERKDFESKANHLGDSGGTPVKTRRHSW
- Top Product
- Discover our top product TBC1D1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TBC1D1 Blocking Peptide, catalog no. 33R-7942, is also available for use as a blocking control in assays to test for specificity of this TBC1D1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBC0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TBC1D1 (TBC1 (Tre-2/USP6, BUB2, Cdc16) Domain Family, Member 1 (TBC1D1))
- Autre désignation
- TBC1D1 (TBC1D1 Produits)
- Synonymes
- anticorps TBC1D1, anticorps TBC, anticorps TBC1, anticorps 1110062G02Rik, anticorps AI385682, anticorps AW555803, anticorps Tbc1, anticorps mKIAA1108, anticorps TBC1 domain family member 1, anticorps TBC1 (tre-2/USP6, BUB2, cdc16) domain family, member 1, anticorps TBC1 domain family, member 1, anticorps TBC1D1, anticorps tbc1d1, anticorps LOC100523386, anticorps Tbc1d1
- Sujet
- TBC1D1 is the founding member of a family of proteins sharing a 180- to 200-amino acid TBC domain presumed to have a role in regulating cell growth and differentiation. These proteins share significant homology with TRE2 (USP6), yeast Bub2, and CDC16.
- Poids moléculaire
- 133 kDa (MW of target protein)
-