MRPL37 anticorps (N-Term)

N° du produit ABIN630997

Détail du produit anti-MRPL37 anticorps

Antigène: MRPL37 (Mitochondrial Ribosomal Protein L37 (MRPL37))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MRPL37 est non-conjugé

Application: Western Blotting (WB)

Specificité: MRPL37 antibody was raised against the N terminal of MRPL37

Purification: Affinity purified

Immunogène: MRPL37 antibody was raised using the N terminal of MRPL37 corresponding to a region with amino acids VRSTRKSEPPPLDRVYEIPGLEPITFAGKMHFVPWLARPIFPPWDRGYKD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MRPL37 Blocking Peptide, catalog no. 33R-9789, is also available for use as a blocking control in assays to test for specificity of this MRPL37 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MRPL37 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MRPL37

Antigène: MRPL37 (Mitochondrial Ribosomal Protein L37 (MRPL37))

Autre désignation: MRPL37 (MRPL37 Produits)

Synonymes: anticorps L37mt, anticorps MRP-L2, anticorps MRP-L37, anticorps MRPL2, anticorps RPML2, anticorps 2300004O14Rik, anticorps AI132596, anticorps Rpml2, anticorps mitochondrial ribosomal protein L37, anticorps MRPL37, anticorps Mrpl37

Sujet: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit.

Poids moléculaire: 48 kDa (MW of target protein)